SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067FKP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067FKP2
Domain Number 1 Region: 24-85
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000183
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067FKP2
Sequence length 143
Comment (tr|A0A067FKP2|A0A067FKP2_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO64027.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g032324mg OC=Citrus.
Sequence
MMENKRSPCAVDQGSLPTLTSKRHKADLSISAKERKEKLGERIIALQQLVSPYGKTDTAS
VLWEAMEYIQFLHEQVKVLSAPYLQSMPAAKVQELEQYSLRNRGLCLVPISCTAGVARSN
GADIWAPIKTTSPKFEKAITQFH
Download sequence
Identical sequences A0A067FKP2 A0A2H5NX86 V4VSH7
orange1.1g032294m|PACid:18124470 orange1.1g032295m|PACid:18124468 orange1.1g032321m|PACid:18124469 orange1.1g032324m|PACid:18124467 clementine0.9_024851m|PACid:19276299 clementine0.9_024852m|PACid:19276298 clementine0.9_024857m|PACid:19276300 XP_006442817.1.91645 XP_006442818.1.91645 XP_006442819.1.91645 XP_006478624.1.29302 XP_006478625.1.29302 XP_006478626.1.29302 XP_006478627.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]