SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067JVE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067JVE9
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.07e-40
Family Poly(A) polymerase, PAP, middle domain 0.0002
Further Details:      
 
Domain Number 2 Region: 133-247
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 7.46e-20
Family Poly(A) polymerase, PAP, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067JVE9
Sequence length 300
Comment (tr|A0A067JVE9|A0A067JVE9_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP27951.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_19031 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MLRCVKLWAKRRGVYGNLNGFLGGVHLAILAAFVCQYYPDASVSALISNFFNTFATWPWP
TPVVLQDGMLTAGAVIETQSFMPIRLPCSPHDCHSNITRSTFYKIRIEFLRGHRLTKDIL
KPDPGWSSIFEPFPYSKQYTRFVKIYLSAPDQDELGDWVGWVKSRFRCLLLKLEELQGFC
DPNPMEYVDMDVLEPNVVFYWGLNPSKSSFTNVKFVEEDFLRNLYSGYHGIHRKMELSIV
QAFELPKNAQFNNANGKNTKAYWKIVDNEQRTPTYSQHLPNYFVGYAATNGDTKYPSAGS
Download sequence
Identical sequences A0A067JVE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]