SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067JY15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067JY15
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.75e-33
Family Chaperone J-domain 0.0000836
Further Details:      
 
Domain Number 2 Region: 243-329
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.09e-22
Family HSP40/DnaJ peptide-binding domain 0.00028
Further Details:      
 
Domain Number 3 Region: 162-241
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.89e-16
Family HSP40/DnaJ peptide-binding domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067JY15
Sequence length 335
Comment (tr|A0A067JY15|A0A067JY15_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP24444.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_25008 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MGIDYYKILQVDRSAKDDDLKKAYRKLAMKWHPDKNPKNKKEAEAKFKQISEAYDVLSDP
QKRAIYDQYGEEGLKGQVPPPGAGGFGPEGGSTTFRFNPRSADDIFSEIFGFSSPFGGMG
DMGGPRASTSGFSRGMFGEDIFSSFRTASGESSNMPRKGAAIERTLPCSLEELYKGHTRK
MKISRDVTDSSGRPTTVEEILAIEIKPGWKKGTKITFPEKGNEQRGVKPSDLVFIIDEKP
HSVFKRDGNDLIVTQKISLVEALTGYTAQVTTLDGRNLSIPINCIISPTYEEVVKGEGMP
IPKEPSKKGNLRIKFNIKFPSKLTAEQKTGIKRLI
Download sequence
Identical sequences A0A067JY15
XP_012087845.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]