SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067KEM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067KEM8
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.72e-21
Family Canonical RBD 0.0018
Further Details:      
 
Domain Number 2 Region: 73-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000244
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067KEM8
Sequence length 179
Comment (tr|A0A067KEM8|A0A067KEM8_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP33463.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_07034 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MSRVYVGNLDARVTERELEDEFRRFGVIRSVWVARRPPGYAFIDFDDKRDAEDAIHELDG
KNGWRVELSHNSRGGGGRGGGRGRFGGSDLKCYECGEPGHFARECRLRVGGGRRRSRSPR
YRRSPSYGRRSYSPRGRSPKRRSVSPRGRSYSRSPPYRGREELPYANGNGARDRRRSRS
Download sequence
Identical sequences A0A067KEM8
XP_012076361.1.15751 XP_020536513.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]