SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067KVL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067KVL7
Domain Number 1 Region: 80-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067KVL7
Sequence length 236
Comment (tr|A0A067KVL7|A0A067KVL7_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP39043.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_00800 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MVSPENMNWLADYGLIDETPVLDANFSVPVSGFSWPVQTLNGSSDAGVEIDGPFGNSEAQ
KESSSKKRGRSESCGASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILVDAI
RRVTQLRGEAQTLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAANSQTS
FLPPPPAIPAAFAAQGQASGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA
Download sequence
Identical sequences A0A067KVL7
XP_012070724.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]