SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067KZY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067KZY3
Domain Number 1 Region: 28-95
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.9e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 159-222
Classification Level Classification E-value
Superfamily ACT-like 0.00005
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067KZY3
Sequence length 242
Comment (tr|A0A067KZY3|A0A067KZY3_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP41707.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_16114 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MAEKVVALLGQKRSRNRDTVNHGGGGESEHEVHILTERERRKKMRNMFTSLHSLLPQLPN
KADKSTIVDEAVKYIKSLQETLQTLEKQRQEKLQGATIVDSIGQSLITSPTEALFESREA
FLAIQGPSKGYPMHNSFPVTLSPACYQTWFSPNVVMSMCGDDAQISVCTLKRPGLLTSIF
YILEKHKLDVVSAHVSSEQFRSIYMIHVHAAGGASGRYPEALSVEDTFKLAAGEMNLWIL
SC
Download sequence
Identical sequences A0A067KZY3
XP_012068322.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]