SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067LBP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067LBP7
Domain Number 1 Region: 24-171
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 7.32e-50
Family Pollen allergen PHL P 1 N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 150-243
Classification Level Classification E-value
Superfamily PHL pollen allergen 4.84e-30
Family PHL pollen allergen 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067LBP7
Sequence length 247
Comment (tr|A0A067LBP7|A0A067LBP7_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP41534.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_15941 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MVMPFIFMLLGFFSTKPNVEAALSWQHAHATFYGPGTGGACGYANLNTDGYGFKNTALST
ALFKNGAACGGCYEITCDSAKDPQWCIKGRYITVTATNFCPPNSSLPNDKGGWCNPPLQH
FDMSTPAFEAIAHYKAGIVPVHYRKIPCTRSGGLRFTVTGKSNFELVLISNVGGTGEISQ
VWMKASGSNKWESLTRNWGANWQSLSNLHGQSLSFAVHAIDGRSVTALDVIPANWAFGQS
FKSKVNF
Download sequence
Identical sequences A0A067LBP7
XP_012068097.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]