SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067LRV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067LRV6
Domain Number 1 Region: 119-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000297
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067LRV6
Sequence length 194
Comment (tr|A0A067LRV6|A0A067LRV6_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ05734.1} KW=Complete proteome; Reference proteome OX=930990 OS=Botryobasidium botryosum FD-172 SS1. GN=BOTBODRAFT_182272 OC=Agaricomycetes; Cantharellales; Botryobasidiaceae; Botryobasidium.
Sequence
MFKALFLVIFGNPDHCLKAATKVCALHQCGSAAIYTTEFSALAGITEWDEKALINAFHDG
LKDQIKMEIAQGKQNMSLRTPTMSYPTHHVQCDPNAMDVDAVHTGPLPRFTDNLCDQLRR
EGACFRCRQHGHMARECPNCQGPPGASRVNSVALTLAPNTRDKFVRNPYYVHSTPTVPAS
ASIMEVSGPAEAGF
Download sequence
Identical sequences A0A067LRV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]