SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067MBQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067MBQ9
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 4.45e-38
Family FAD-dependent thiol oxidase 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067MBQ9
Sequence length 173
Comment (tr|A0A067MBQ9|A0A067MBQ9_9HOMO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome; Reference proteome OX=930990 OS=Botryobasidium botryosum FD-172 SS1. GN=BOTBODRAFT_175876 OC=Agaricomycetes; Cantharellales; Botryobasidiaceae; Botryobasidium.
Sequence
MGPDGKPCKPCNSFRTWSKAQRAAQQPSGGKGGASTAAAGGTLAALGAAAAATTSSSDPR
ANCPADVEQLGRATWTFLHTTAAYYPERPSPAQRTHMLGLLNSLPVLYPCSHCASHLGEC
MKANPPDVTGRGSLSRWLCERHNEVNEMLGKEKFDCAKTDERWKDGPADGSCD
Download sequence
Identical sequences A0A067MBQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]