SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067N5M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067N5M5
Domain Number 1 Region: 92-224
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.33e-36
Family Cap-Gly domain 0.00011
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.32e-19
Family Ubiquitin-related 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067N5M5
Sequence length 237
Comment (tr|A0A067N5M5|A0A067N5M5_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ19417.1} KW=Complete proteome; Reference proteome OX=930990 OS=Botryobasidium botryosum FD-172 SS1. GN=BOTBODRAFT_153331 OC=Agaricomycetes; Cantharellales; Botryobasidiaceae; Botryobasidium.
Sequence
MSTQVKVWITSPDTHSERRYDLHMSVKELKSKLEFVTGIAVDAQVLSLYRSGGDPAPIRT
LDDDARPLGYYGVADGMLIKIHDINPSASLTGQFTDVSQVEKFEISEQEYAKRDDTVLAF
KRRNKIGRFAEPTEGDSQVEPEEQVDIQVGSRCEVQIAEDTMKKRGVVRYVGRTKFGKAG
ITWVGVEYDEPVGKHDGVVQNERYFTCPPLHGAFVRAAHVKVGDFPPIDVFAEEEEM
Download sequence
Identical sequences A0A067N5M5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]