SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067NG96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067NG96
Domain Number - Region: 63-97
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000112
Family Retrovirus zinc finger-like domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067NG96
Sequence length 159
Comment (tr|A0A067NG96|A0A067NG96_PLEOS) Uncharacterized protein {ECO:0000313|EMBL:KDQ26829.1} KW=Complete proteome; Reference proteome OX=1137138 OS=Pleurotus ostreatus PC15. GN=PLEOSDRAFT_30016 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Pleurotaceae; Pleurotus.
Sequence
QQYAHMKIRFDDPAQANKAIRDGVFVQGKIVSVWKDEQEPPMCYRCHNVGDGHFAASCTV
EIELCGHCSEKHWSRDCPNPGAKWCHKCKKAGHRVGDRTCESRRQALEMMRRADPEARQR
YFMERDNPETWGNPPAWERRGKRGRQWERGKLAGALPAR
Download sequence
Identical sequences A0A067NG96
jgi|PleosPC15_1|30016|e_gw1.6.370.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]