SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067NNZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067NNZ8
Domain Number 1 Region: 55-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000306
Family Regulator of G-protein signaling, RGS 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067NNZ8
Sequence length 529
Comment (tr|A0A067NNZ8|A0A067NNZ8_PLEOS) Uncharacterized protein {ECO:0000313|EMBL:KDQ25807.1} KW=Complete proteome; Reference proteome OX=1137138 OS=Pleurotus ostreatus PC15. GN=PLEOSDRAFT_1097562 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Pleurotaceae; Pleurotus.
Sequence
MSSARRYSSQTRPKTYQPTLHGLLSLPHRLCHPPQAVGKVRSCGMTPIYKVRLEDVLNRK
HLPPLGLKDFEEWLLYVELCPENLYFVLWLREYTVRYEHWVRTCKTHRESSDYRVSWPLE
SSSQLAMFYARAKQTFFTANSDYELNVPSDILTPFHLQNGSLHPDPAVFGEVSAEVNKML
QESLDRFVLAAYNNVGNNRVLCGMIAGVTFTLIGGLPPLAANFALGASRWLRLVAIPGIW
LGLTIFLAAFYGVCLGIYIFGDFPYYDPDPIEGPATTPISLDVNYEFPPGGKSAHDIDDD
MTSFATTASFIHPFDSVGLNSMDFEKHPPEDHQPISPFDFDSLPSRRSAVVMIQPERAPW
GGASKFSLRAMMAGIQMWCTGNRWLLSVDNVARGVDLEKGEGVMAPEGISEKESRRSSVH
ISDPPIPPHLPPPPHPQSSQQPRSTQDPPTPTELKDAIVNAIAHTPVEARVRTQFKLVKA
VPAFASPLTKVLNPIVVRGQWEIVVRSAALAFLLSWVVVGSLVAIPVRR
Download sequence
Identical sequences A0A067NNZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]