SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067NYF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067NYF8
Domain Number 1 Region: 197-268,305-355
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.85e-27
Family cAMP-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 361-487
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-26
Family cAMP-binding domain 0.00013
Further Details:      
 
Domain Number 3 Region: 4-37
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000068
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067NYF8
Sequence length 505
Comment (tr|A0A067NYF8|A0A067NYF8_PLEOS) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1137138 OS=Pleurotus ostreatus PC15. GN=PLEOSDRAFT_1063972 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Pleurotaceae; Pleurotus.
Sequence
MSTFDTLVDDLTRDVHRAQPKDALQFCANWFQSRLEEQRARTRDILAQRSYSVTGSLPKE
IYVDTPLDTVANGTAMQSSFSPFTVATPPRFVSLRGSISHQPSPFGTLNVPGNALLSEDQ
DGPPTFQIDGRDMAPTSPLTTGVPNPFAGFDGNNNLSAVNANPGDYLHPPMSAIFARRTS
VSAESILVDSGNDEPTPVYQKTPEQLSRIRASIGKNFIFRDLDEEQETGVLNAMQEQRVS
TNEVVIRQGDVGEYFYVVESGLLHCYIHAEPLPPSWVTENKNCPGTIVMDTGTAFVQPGY
HPEFGREVAKCTPGNSFGELALMYGHPRAATVLAKQPSVLWAVDRITFRTIILKAAHRRR
TMYEQFLSSLSLLSSLDPPERSKIADALQSRSYEDGQPVVRQGEMGDTFFFVEDGEAVVT
KRHEGGEEIEVGHLKKGDYFGELSLLRLAPRAATVSAAYRPDPSAPKLKTAALDAAAFTR
LLGPLREIMERKASESYSGYRPNPR
Download sequence
Identical sequences A0A067NYF8
jgi|PleosPC15_1|44444|estExt_Genewise1.C_40873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]