SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067Q0T0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067Q0T0
Domain Number 1 Region: 106-196,223-286
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000275
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067Q0T0
Sequence length 686
Comment (tr|A0A067Q0T0|A0A067Q0T0_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ60683.1} KW=Complete proteome; Reference proteome OX=933084 OS=Jaapia argillacea MUCL 33604. GN=JAAARDRAFT_31662 OC=Agaricomycetes; Agaricomycetidae; Jaapiales; Jaapiaceae; Jaapia.
Sequence
MSWFASLFSSGSSRRKNQAMTSTHDAFTLPTSSPGFNQPDGFQASTPTPDPESATGSYTY
PPQSAASPYDFMPSSSNSRARPASLLPLHHSPLPPLPPYPPLSQTWNRLRQWLSDEYPEL
GDTLNWGVLPQDLAQIEMHFGFELPAPIRESYLITDGQEPESSAGCSEGLFFGLTLLPLE
DVLEEWRFWREVDDDPATGANAKLREVMQSIPPGYIRKAYSSRGWIPLISDKTGNYLGVD
LSPGEAGAPGQVIVFGRDFDTKVVMWRGDGPGGWAKWLLSFVEELESGEGFELGVTTESE
GSEDDVGYESYFYDGSGRGQGDGGGATGTSGLRLIGEYRGWSVLEAWADRSVRKWEEAGL
APDLSSLPQEKGKAPEHLPVESLDLSAMGKISDALVPMPVVAEVEPEPVLVAPFNNVTNQ
SGPKPPRSAVPTISVTKPPAPLPVLLPTEVDIDSPPSSPDTESSLDVDLEAGSGILMREV
ELTQERTPSASATVYAPPVIGSTFVSGAGEATLVPLPISPPQQTPTGLVQGTTAPATAMT
DITDLLVEPALPLAPPIQPSSPPSASSLNGVYVDIPAATPTPLPDSSPETRALEPAQIVD
ATSIRLVGGGGVVGISEELNGEESTDTPGDFASDAAEVSSISSQPTEPTPAIKHDKKKSI
TSGFKRISQLGGKRRKDSSSSLKDAK
Download sequence
Identical sequences A0A067Q0T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]