SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067Q6Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067Q6Z5
Domain Number 1 Region: 23-118
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.31e-30
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 272-357
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.49e-18
Family HSP40/DnaJ peptide-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 142-222
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.49e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00067
Further Details:      
 
Domain Number 4 Region: 129-160,226-265
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000144
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067Q6Z5
Sequence length 375
Comment (tr|A0A067Q6Z5|A0A067Q6Z5_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ59262.1} KW=Complete proteome; Reference proteome OX=933084 OS=Jaapia argillacea MUCL 33604. GN=JAAARDRAFT_33989 OC=Agaricomycetes; Agaricomycetidae; Jaapiales; Jaapiaceae; Jaapia.
Sequence
MSILSSRLIFLILLLCAALVCAADLYKTLEIDRSASEQDIKKAYKRLSRKYHPDKNKDPG
AEDRFVEVAYAYEVLSDSTKRQIYDRHGEEGLKAHEGGQQPHANPFDIFSSFFGGSQQQQ
QVRRGPTSVTEFEVSLADMYKGASIDFMIQKRILCDHCRGTGAASSSDIHTCSGCGGSGI
KLVKQQIFPGMFAQSQMQCNECGGRGKIIAKPCPHCSGNKVMDHTAHYTLEIGKGMPEGK
EVVFEGEGDESPDWEAGDVVLRVRSKKEQGGWRRKESSLYWKETIGVHEALLGFERNLTH
LDGHIVELKRKGVTQPGFVQFIPEEGMPFYDQPAYHGDLYIEYNVVLPTELTSDTRKKLS
QAFFGRDHPPGKDEL
Download sequence
Identical sequences A0A067Q6Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]