SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067Q7F5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067Q7F5
Domain Number 1 Region: 82-222
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.91e-27
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.075
Further Details:      
 
Domain Number 2 Region: 226-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000000141
Family Archaeal tRNA CCA-adding enzyme substrate-binding domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067Q7F5
Sequence length 280
Comment (tr|A0A067Q7F5|A0A067Q7F5_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KDQ62953.1} KW=Complete proteome; Reference proteome OX=933084 OS=Jaapia argillacea MUCL 33604. GN=JAAARDRAFT_360875 OC=Agaricomycetes; Agaricomycetidae; Jaapiales; Jaapiaceae; Jaapia.
Sequence
MTMHSRGQNSTSSGPSKPYPDFIPLSQPSSGIGASGSRSQGQRKNEKKRKHPASPAVGGD
DDPMHTPWLDSLGMTEYESKEQRLHDEIVAYVAYIAPTQAETSARHFVITHLHEVIKRRF
RDAALRMFGSVVHQVCLPDGDIDLVLETVHVVDTKEDQKRALFQLRNRIRDAQLANDIQV
VGQARVPIINLKTTPQYGSFDVDISINNTDGVHAIDIISSYMTSIPALRPLLFTLKGFLS
QRQLNSAASSTLSSYCLICMVISFLQVRFSIYRLYVTFPL
Download sequence
Identical sequences A0A067Q7F5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]