SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067QJX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067QJX0
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000194
Family Ovomucoid domain III-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067QJX0
Sequence length 90
Comment (tr|A0A067QJX0|A0A067QJX0_ZOONE) Uncharacterized protein {ECO:0000313|EMBL:KDR07983.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_02435 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MHLRSSEATMNCFSFVFLGVIMAFVVLTAAEECALICPMIYAPVCATDGDTTQTFSSACG
LNVYNCQHSENPLRLLRSGACDSDDSNVDS
Download sequence
Identical sequences A0A067QJX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]