SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067QQ35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067QQ35
Domain Number 1 Region: 249-465
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.99e-38
Family Reprolysin-like 0.004
Further Details:      
 
Domain Number 2 Region: 550-607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000445
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 827-883
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067QQ35
Sequence length 1047
Comment (tr|A0A067QQ35|A0A067QQ35_ZOONE) A disintegrin and metalloproteinase with thrombospondin motifs 7 {ECO:0000313|EMBL:KDR11853.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_14224 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MAVLRLALCVFLLFGASCGFKFADRGWRDKPHEGRYTKGIGDYDLLVPVRVDPEGSFVSH
SLPSFFQQDVRRRKREARADSERVHYGINLDGQDHVVELWPNHGLISPGFVVETRQSGSA
SDLNKLKIRSVNDSQCHYTGRIKGQPESRVALSTCDGIVGHIRTKRDVYLIEPVEGHEPE
VNGQHLHLVYKRSASHDRKGKCGTRNDWETAWANRLKNEYNQKKDNARKRSVSDDTRMGF
NRKRSAEDQTKFIEVMLVADKKFLEVRKDIDYEQYLLTTVNMASDILHDETVGQTMDLVL
VRLMYLEKEDEEVDLTINIDADATLTSFCKWSTRMNPVLTHPNHHDISVLVTKHDICLGP
DGCGTSGLADIAGACARNQSCAICEDKGLVVGTISAHEIVHLLGADHDSEDENAPPGECP
GIVEGYNIHVMSPYSQVSPASWSTCSKKFIAEFFENDLGKCFLDEPQEHNFKFPEMLPGV
LYDREWQCIDNFGPMEPCDHGPDKNCKYLTCRTAGAQECTFIGPPADGTSCGDNKWCFGG
KCVVVGVRPNAVNGQWGEWLSWSECSRTCGGGVSVSERQCDNPRPANHGRYCLGKRRRYK
ICNTEPCDDNSSFRAEQCEAYNTDDIKWTPFNDETPESVCALVCSNNKHEYRTLKPRVKD
GTPCKIGSRDKCIAGKCRNVGCDWVLDSEAVEDVCGVCDGDASTCDFVDEVNSESGEDYQ
EITTIPAGARHVSVEEVTASRNLLALSAADRKTFFLNGDYTVEEDGVKRIPGSIVLYNNV
DPQRETLYIEGPTKEDLILYILNNKDPNPGIHYKYSIPSTSAYDPKFVWDLVDWGPCSAF
CGGGTQLSQPSCFEEKRGKVSKMHCKDIPKPTANTRSCNTQSCKVRWRVGEWGRCSGCIG
RPGHKYRVVDCVKQSPFEDSEDMIEPSECEGQKPSNKELCSSNKPCAVNYRKRHTSLQRD
ASESGDENGILIIDKPNPDRFKVVEVPKNQGVNNLNLSDEALEALGDQVASNMDATKTGE
EAHKRLKEGKEQIEVEDGEEDDILNLY
Download sequence
Identical sequences A0A067QQ35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]