SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067QUP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067QUP2
Domain Number 1 Region: 31-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.83e-26
Family Insect pheromone/odorant-binding proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067QUP2
Sequence length 150
Comment (tr|A0A067QUP2|A0A067QUP2_ZOONE) General odorant-binding protein 19a {ECO:0000313|EMBL:KDR13656.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_11989 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MKGNKMHWSSVVFVVMATLLLEFKQTSGELTLEEIQKANIILRKHCQPTSGVSDDVLEAS
MKGNFADDRNLKCYLACMMGLTHALKNGQYRAELAIRLADDILPEAIKGKARSVVEKCRN
AADGLTDECDMAFAIKKCAYEADPEIYYVQ
Download sequence
Identical sequences A0A067QUP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]