SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067QVL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067QVL6
Domain Number 1 Region: 136-204,233-262
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000377
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 7-104
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000851
Family DBL homology domain (DH-domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067QVL6
Sequence length 334
Comment (tr|A0A067QVL6|A0A067QVL6_ZOONE) Uncharacterized protein {ECO:0000313|EMBL:KDR09960.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_15794 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MPIMTAGYRRYLSGLKRADCLLAAKTRNPDFMRLIVEPPVPRRRPDLTAFIHKPLEHYRD
VLKLLQTILNYTKVKDEDYSALLRVVQELQTTYREATMGSGLMEPEGEGRPLLSLQDLES
RLVFTRCKPFVLSSPGRQWIFGGDLSRVEGRSVRPFWALLFTDLIVFAKVSRDRVLFITE
EPLSLLSVTQAFFNIRKKANEFRLLLDGDAEGMDSPVPGGCGPELPLSRNPKKSARRRTI
SLRAPTAELKAVWQNLIQRQIIYLNTTRGGTPASSPLDSPDPPTTLSVATLDSFPLRRQV
RPLLKEPAPTPPCPSPSPPRTLTPYSSPKRSSSQ
Download sequence
Identical sequences A0A067QVL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]