SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067R3W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067R3W5
Domain Number 1 Region: 508-556
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000017
Family TSP-1 type 1 repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067R3W5
Sequence length 568
Comment (tr|A0A067R3W5|A0A067R3W5_ZOONE) Spondin-1 {ECO:0000313|EMBL:KDR13866.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_12154 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MQSLIQLIVCILVAKELNRAEAIYCNRDPEDIHTPKSKNSPFRIRISGNPDKYVPEGVYT
VSLRGQRSGRYQATFERFMLVVEPKDHSSSENNDTGDKNVGSFALVGNTIAKYSNQCPNA
IIQMSSLKKAEVKVTWTAPPPGSGCVVFRATIVEDHEVWYKDGELSHEFCEDDQENEFYQ
PEFDFTCYACDDALYEMTFEGLWSKYTHPKEFPENGWLTGFTDLIGASHSPHYYFWEYGR
FASEGLRLVAELGSTHELEKEIIAKSKNIRTIIKARGLAYPNVTGKTSTFFRVDRKHYLF
SVVSRIAPSPDWIIGVSGINLCLKNGSWVDYREFDLYPLDAGTDNGITYMSPDEPTSPHK
VVIRITSSYPNDPRSPFYDPSGSKVLPLARLYLRRWQLFERECCNESEENCNVDQQLKMG
NLKKKKEKRKQIWLPDDEEIDGVASTSEPEVTDDTTKEDSTVVSPLNELSSSYFLDFNMT
YGLMVSTLPTYNFESEVEPRNVVEGRVIDCVVSRWTRWSKCSVSCGCGYKTRNRSILVHS
RNGGKACPKLLRTKKCLKKCGKNNWGRG
Download sequence
Identical sequences A0A067R3W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]