SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067RHP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067RHP9
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.96e-21
Family Chemosensory protein Csp2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067RHP9
Sequence length 123
Comment (tr|A0A067RHP9|A0A067RHP9_ZOONE) Ejaculatory bulb-specific protein 3 {ECO:0000313|EMBL:KDR22558.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_12686 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MIAGTTVTLICLLAALCVSGDSYPEEYDRLDMGDLLGDKEKLAKFSACLRDEGSSSCTEK
SAGLKAFLLDALKTKCSKCTESQKGHVKRAAIFFSENRPDDWKIIIHKLQLNETQAAELI
KSF
Download sequence
Identical sequences A0A067RHP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]