SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067RJV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067RJV3
Domain Number 1 Region: 162-370
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.4e-50
Family Reprolysin-like 0.0049
Further Details:      
 
Domain Number 2 Region: 458-514
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000994
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 
Domain Number 3 Region: 736-794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067RJV3
Sequence length 857
Comment (tr|A0A067RJV3|A0A067RJV3_ZOONE) A disintegrin and metalloproteinase with thrombospondin motifs 12 {ECO:0000313|EMBL:KDR20850.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_04654 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
GRYTRHIEDHKFLAPRKINKDGEFLSYSIPHFYERDTSRRKKRDLPDESEKVHYGLAIYG
KEQLVELWPNYDFISPGMMIEERGPGASVDVNKVKIRPANRTQCHYVGRVKGQNNSRVVL
SVCDGMSGYIKTNEGHYFIEPMKGHQREEDGLQVHIVHKRSLLVVADKSFLYYHKNIDVE
TYILTVMNMASDFYHDASSGNLMDIVVVRIIYLYKQEEEKDLYINRDAEKTLKSFCEWQA
SVNPQDVTHPNHHDIAVLLTRYDICSDNVTECGLLGLAYLAQACNPKMSCAICEDTGLAL
GITVTHEVGHVMGCGHDDKIDSECEPMADKVNAHVMSPYVQMATANWSTCSKKFMQEFLD
NGLGDCLLDEPQEYNFNLPDMPPGAMYDANFQCAQDFKIPDTVSCDMGPEANCEALYCEH
TPKKCGSHMQPPADGTRCAANKWCYNRKCVPYGLRPQARNGEWGAWTSWSDCSRTCGGGV
SFSERDCNNPAPQNHGRYCLGARKKYRVCNTSPCDPKDATFREEQCSQHDDTVHHWTPFL
KIEPKEVCNLLCINEDGIIKSMSPRVKDGTPCRPGTKDLCTAGTCQVVGCNWILGSDAVE
DQCGVCNGEGKECTIVEDTFKDTGRGYVKIATIPAGSMRISIEELNPSTNTLALKAEDDK
TFYLNGDYSEESDKELHLSGTVGYYFHPKADQEKIVIDGPTTNQILLYGCFFGDANPGIT
YKYAMPNSGQKETYEPKYHWEFVEWGECNRRCGGGTQESEPKCVEKRDGVVSDSFCPSAD
KPKVTNRPCNQEPCKARWKPGQWGKCNGCVFKTGYRIRGVECIQESPIKNEETRTDDRNC
KGKKPQHAVLCNSFKPC
Download sequence
Identical sequences A0A067RJV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]