SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067RNW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067RNW2
Domain Number 1 Region: 27-201
Classification Level Classification E-value
Superfamily TIMP-like 6.75e-42
Family Tissue inhibitor of metalloproteinases, TIMP 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067RNW2
Sequence length 225
Comment (tr|A0A067RNW2|A0A067RNW2_ZOONE) Metalloproteinase inhibitor 3 {ECO:0000313|EMBL:KDR22300.1} KW=Complete proteome; Reference proteome OX=136037 OS=Zootermopsis nevadensis (Dampwood termite). GN=L798_01170 OC=Termitoidae; Termopsidae; Zootermopsis.
Sequence
MVKRILIHTAFSVVLLVAASINMASSCSCMMSHPQTHACRADFVIVARVKKVFTHDGMSR
VYKVKIKREFKMSEKASVVLKAGRLVTGGSSSTCGVQLEPEVTYLITGKVLAGQAHVNLC
NYITNWNDLTVRQKKGFRLLYRQGCLCEIIDCPWWKQCPRDRLEADACLWESSVFSDASL
PDCQSKHGICMKTPSGNCGWSTDKKYRECMKERRRMRDERRRNEP
Download sequence
Identical sequences A0A067RNW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]