SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067S633 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067S633
Domain Number - Region: 53-131
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00471
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Domain Number - Region: 172-229
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 0.0476
Family Uronate isomerase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067S633
Sequence length 248
Comment (tr|A0A067S633|A0A067S633_GALM3) Uncharacterized protein {ECO:0000313|EMBL:KDR66271.1} KW=Complete proteome; Reference proteome OX=685588 OS=Galerina marginata (strain CBS 339.88). GN=GALMADRAFT_17237 OC=Galerina.
Sequence
MTKVVNLLSAKAEMGAPMICMYLLGNPDHYTNYTFVPFYWQSFKGKILGLSPVYDYIYRS
AALENLCLYDWIQHYERKKVKKAKVVNTANEINDNVIENEAADQSNISLDSYLEDDGENE
EPKSTSKNVFRFTQKHPLHDSHASHYISKSEKRIPNFIGATLPRCDQGDRNYYCSTMLTL
FKPWRKGYDLKSNDTETWDECFNNYKFSNQQEKLMQNFNIKYECLDARDDYRAQLKKGLD
KGLIGSWD
Download sequence
Identical sequences A0A067S633
jgi|Galma1|17237|gw1.59.16.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]