SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067SZD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067SZD7
Domain Number 1 Region: 14-143
Classification Level Classification E-value
Superfamily Prefoldin 2.62e-29
Family Prefoldin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067SZD7
Sequence length 154
Comment (tr|A0A067SZD7|A0A067SZD7_GALM3) Uncharacterized protein {ECO:0000313|EMBL:KDR73034.1} KW=Complete proteome; Reference proteome OX=685588 OS=Galerina marginata (strain CBS 339.88). GN=GALMADRAFT_228711 OC=Galerina.
Sequence
MSQQQTINISDLDVAQLSEVRKQLEDELNHLTNSFAQLKQAQAKFKACLENVNEVRPVNK
DKTILVPLTNSLYVPGKLADPEHVIVDIGTGYYVKKTRPQAVKHYADKVEYIRTNVDTLE
DTIQKKRDNMNYLTSLLQQKIQAETQGGPTSRGS
Download sequence
Identical sequences A0A067SZD7
jgi|Galma1|228711|fgenesh1_pm.21_#_252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]