SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067T1H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067T1H5
Domain Number - Region: 57-93
Classification Level Classification E-value
Superfamily F-box domain 0.00203
Family F-box domain 0.0074
Further Details:      
 
Domain Number - Region: 298-363
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.1
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067T1H5
Sequence length 539
Comment (tr|A0A067T1H5|A0A067T1H5_GALM3) Uncharacterized protein {ECO:0000313|EMBL:KDR76946.1} KW=Complete proteome; Reference proteome OX=685588 OS=Galerina marginata (strain CBS 339.88). GN=GALMADRAFT_246084 OC=Galerina.
Sequence
MADWVHWNDSSILNGLNSSKDAAISRLHPDLLWFIFGKNSEIPPSTDFHERLATARATSQ
VCRQWREVVLRSSALWGRLIDLDLLHQPNWRDEVLSRTGNSLLWIQGTISLSNREFFFTL
LDQHWTRVQKLEVIEVSGIHDRNLHIWEVLYRPARHLQTIRISLGHNDQESYPSGTLFSD
AAPTLREFSASAFRFNPCAPWLSGICNMTFAHHFTIPEIFEALGMMPLLECLSIRSGPRQ
WQLINPDNMIFPDLSQILLPRLTKLTLIGKIHVCLPFLACLAPRTGCSLLATISPMRDAQ
WDPNIPTLLDATSKHMVKYSRNYFTTHTMTRASLECSSFWVEFRDISDPNPDENPSYVIE
IYDSQELSMALLTELATPSFMTSVEVLHLDISLVQTYLTQPLTSLLPLLHSVVNLETNDD
ALEFILEHFLYPFSLFPVLHTITAHRINNLEHSSQYPSGVFFSFMKKRKDAGFPVSVFDL
TKFPIRRSYDMDFLEGLTGLVVKWMQDDEVREYLCGSGSPHQLRFSRILRMSEDDDSAE
Download sequence
Identical sequences A0A067T1H5
jgi|Galma1|246084|fgenesh1_kg.11_#_138_#_Locus9302v1rpkm3.42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]