SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067Y4C0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067Y4C0
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Photosystem I subunits PsaA/PsaB 4.71e-111
Family Photosystem I subunits PsaA/PsaB 0.00000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067Y4C0
Sequence length 256
Comment (tr|A0A067Y4C0|A0A067Y4C0_9PHAE) Photosystem I reaction center apoporotein A1 {ECO:0000313|EMBL:AGW31526.1} OX=87238 OS=Scytosiphon canaliculatus. GN=psaA OC=Scytosiphonaceae; Scytosiphon.
Sequence
LHADAHDFDTQTNSLEEVSRKIFSAHFGQLSIIFLWISGMHFHGAYFSNYLAWLNNPISI
KPSAQVVWPIVGQEILNGDVGGNFQGVQITSGFFQLWRAEGITSEIELYWTAIGGLIMSG
LMLFGGWFHYHKAAPKLEWFQNAESMLNHHLSGLLGLGCLSWSGHQIHVALPINKLLDAG
VASQEIPLPYEFLINRELIGQLYPSFKKGLVPFFSLNWGEYSDFLTFKGGLNPVTGGLWL
SDTAHHHLALAVLFIV
Download sequence
Identical sequences A0A067Y3B3 A0A067Y4C0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]