SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067ZWC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067ZWC1
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily Histone-fold 8.72e-50
Family Nucleosome core histones 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067ZWC1
Sequence length 119
Comment (tr|A0A067ZWC1|A0A067ZWC1_ALTAL) Histone H3 {ECO:0000256|RuleBase:RU004471} OX=5599 OS=Alternaria alternata (Alternaria rot fungus) (Torula alternata). GN= OC=Pleosporaceae; Alternaria; Alternaria alternata group.
Sequence
ATGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFWR
LVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAKRVTIQSKDIQLAR
Download sequence
Identical sequences A0A067ZWC1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]