SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068B7Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068B7Z6
Domain Number 1 Region: 9-82
Classification Level Classification E-value
Superfamily HMG-box 0.00000000012
Family HMG-box 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068B7Z6
Sequence length 138
Comment (tr|A0A068B7Z6|A0A068B7Z6_9GLOM) MATA_HMG {ECO:0000313|EMBL:AIC80837.1} OX=588596 OS=Rhizophagus irregularis. GN=HMG49 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
DMSKMNKGNGFMVYRKTLNKHLEILGERITMQQLSPLAGSLWGSEPDQVKEFYKELSEKI
KKVHNDRVESYIKNNRNENMSRKTIKDMTTKNGGNGFIIFRKQLNELLRSLGYNFSMQEH
SKIASYLWSIQPKEVKSH
Download sequence
Identical sequences A0A068B7Z6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]