SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068D424 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068D424
Domain Number - Region: 26-78
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.00126
Family eIF-2-alpha, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068D424
Sequence length 135
Comment (tr|A0A068D424|A0A068D424_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:AID29340.1} KW=Complete proteome OX=763057 OS=Mesorhizobium huakuii 7653R. GN=MCHK_1517 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MATKRVPPTPIAADATIADMVETLDKPVEYVRRVLEKLERCKRAHGDAQVRVGVRGRAEA
PNYLIEYVREDKKTLERVTYQDAAYSGSTHRELAPHHIAEARNWSPEEMNITAVSALIGR
LRNPRAPSSRFADED
Download sequence
Identical sequences A0A068D424 A0A1A5I819 A0A1E2SXN5 A0A2A3BUA4 Q983T4 W9E629
gi|13476766|ref|NP_108335.1| WP_010915422.1.100680 WP_010915422.1.15801 WP_010915422.1.18636 WP_010915422.1.29505 WP_010915422.1.29585 WP_010915422.1.37186 WP_010915422.1.45716 WP_010915422.1.54613 WP_010915422.1.60724 WP_010915422.1.62138 WP_010915422.1.7437 WP_010915422.1.86590 266835.mlr8188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]