SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068DF28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068DF28
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.12e-64
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068DF28
Sequence length 165
Comment (tr|A0A068DF28|A0A068DF28_9RHIZ) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=763057 OS=Mesorhizobium huakuii 7653R. GN=MCHK_5159 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MNDQRADVAIIMGSQSDWATMRQAAETLEALGVPHKRLIISAHRTPDRLYEFAKGAKAAG
YKVIIAGAGGAAHLPGMTAAMTPLPVFGVPVESKALSGQDSLLSIVQMPAGIPVGTLAIG
KAGAANAALLAAAVLALNDDKLAQRLDAWRASQTAKVADEPTDTP
Download sequence
Identical sequences A0A068DF28 A0A1A5JMT9 A0A1E2SPY0 A0A2A3BZ08 Q98FE6
gi|13473268|ref|NP_104835.1| WP_010911966.1.100680 WP_010911966.1.15801 WP_010911966.1.18636 WP_010911966.1.29505 WP_010911966.1.29585 WP_010911966.1.37186 WP_010911966.1.45716 WP_010911966.1.54613 WP_010911966.1.60724 WP_010911966.1.62138 WP_010911966.1.7437 WP_010911966.1.86590 266835.mlr3809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]