SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068EVF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068EVF5
Domain Number 1 Region: 151-487
Classification Level Classification E-value
Superfamily gp120 core 1.37e-173
Family gp120 core 0.000000000121
Further Details:      
 
Domain Number 2 Region: 535-660
Classification Level Classification E-value
Superfamily Virus ectodomain 1.17e-59
Family Virus ectodomain 0.00000828
Further Details:      
 
Domain Number 3 Region: 84-132
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000169
Family gp120 core 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068EVF5
Sequence length 851
Comment (tr|A0A068EVF5|A0A068EVF5_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVTEMRRNYQHLWKWGTMLLGILMICNVAGNLWVTVYYGVPVWKEATTTLFCASDARAY
DTEVHNVWATHACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVK
LTPLCVTLNCTDLRNATNTTSSSGEKMERGEIKNCSFNITTSIRDKVQKEYALFYKLDVI
PIEKDNTGYRLISCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCKDKKFNGKGPCTNV
STVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSENFTNNAKVIIVQLNESVEINCTRPNNN
TRKSIHIGPGRALYTTGEIIGDIRQAHCNISSAKWNSTLRQIAIKLREQFKNKTIVFNHS
SGGDPEIVTHSFNCGGEFFYCNSTPLFNSTWNGTEGSNNTEGNGTEPITLICGIKQIVNM
WQEVGKAMYAPPIRGQIRCSSNITGLILTRDGGKSENGTTETFRPGGGDMRDNWRSELYK
YKVVKIEPLGVAPTEAKRRVVQREKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARLLL
SGIVQQQNNLLRAIEAQQHMLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICT
TTVPWNTSWSNKSLEHIWQNMTWMEWEREIDNYTDLIYTLLEESQNQQEKNEQDLLALDK
WASLWNWFSISNWLWYIKIFIMIVGGLIGLRITFTVLSIVNRVRQGYSPLSFQTRLPAPR
GPDRPEGIEEEGGERDRDGSSPLVDGFLTLIWVDLRSLCLFSYHRLRDLLLIVARIVELL
GRRGWELLKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVLEVLQRAYRGILHIPR
RIRQGLERALL
Download sequence
Identical sequences A0A068EVF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]