SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068EVS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068EVS6
Domain Number 1 Region: 166-503
Classification Level Classification E-value
Superfamily gp120 core 1.77e-175
Family gp120 core 0.000000000194
Further Details:      
 
Domain Number 2 Region: 552-677
Classification Level Classification E-value
Superfamily Virus ectodomain 9.1e-59
Family Virus ectodomain 0.00000629
Further Details:      
 
Domain Number 3 Region: 84-133
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000824
Family gp120 core 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068EVS6
Sequence length 868
Comment (tr|A0A068EVS6|A0A068EVS6_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MKVKGIRKNCQNLWKWGTILLGMLMICSAAEKLWVTVYYGVPVWREATTTLFCASDAKAY
DTEAHNVWATHACVPTDPNPQEVLLGNVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVK
LTPLCITLNCTELGNITAGESMNSTTGMNSTTGERNRTWENGTYGEIKNCSFNITTSIRN
KVQKEYALMYKVDLVPIDDDNDSYSYRLINCNTSVITQACPKVSFEPIPIHYCTPAGFAI
LKCNDKKFNGTGPCKNVSTVQCTHGIKPVVSTQLLLNGSLAGEEVVIRSENFTDNAKTII
VRLNKTVEINCTRPNNNTRKSIPIGPGRAWYTTGDIIGDIRQAHCNLSITQWNKTLEQIA
MKLREQFKNKTIVFNQSSGGDPEIVTHSFNCGGEFFYCNTTVLFNSTWNDTSSWKVTEGL
NDTITLQCRIKQIVNMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGNNMHNETEIFR
PGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGTIGAMFLGFLGAAGS
TMGAASVTLTVQARLLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLR
DQQLLGIWGCSGKLICTTAVPWNASWSNKSLNDIWNNMTWMEWEREIDNYTNLIYSLLEE
SQNQQEKNEQELLELDKWASLWNWFNISNWLWYIKIFIMIIGGLVGLRIVFTVLSIVNRV
RQGYSPLSFQTSLPTPRGPDRPEGTEEDGGERDRDRSDRLVNGFLALIWDDLRNLCLFSY
HRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQEIKNSAVSLLNTTAIAVAEGTDR
IIEVVQRIFRAVLHIPTRIRQGLERALL
Download sequence
Identical sequences A0A068EVS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]