SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068EVS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068EVS9
Domain Number 1 Region: 166-503
Classification Level Classification E-value
Superfamily gp120 core 7.26e-177
Family gp120 core 0.000000000168
Further Details:      
 
Domain Number 2 Region: 552-677
Classification Level Classification E-value
Superfamily Virus ectodomain 1.76e-57
Family Virus ectodomain 0.00000744
Further Details:      
 
Domain Number 3 Region: 84-133
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000392
Family gp120 core 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068EVS9
Sequence length 868
Comment (tr|A0A068EVS9|A0A068EVS9_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MKVKGIRKNCQNLWKWGTMLLGMLMICSAAEKLWVTVYYGVPVWREATTTLFCASDAKAY
DTEAHNVWATHACVPTDPNPQEVLLGNVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVK
LTPLCVTLNCTELGNITAGESMNSTTGMNSTTGERNRTWENGTYGEIKNCSFNITTSIRN
KVQKEYALMYKVDLVPIDDDNDSYSYKLINCNTSVITQACPKVSFEPIPIHYCTPAGFAI
LKCNDKKFNGTGPCKNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRSENFTDNAKTII
VQLNKTVEINCTRPNNNTRKSIPIGPGRAWYTTGDIIGDIRQAHCNLSITQWNKTLKQIA
MKLREQFKNKTIVFNQSSGGDPEIVTHSFNCGGEFFYCNTTVLFNSTWNDTSSWKVTEGL
NDTITLQCRIKQIVNMWQEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGNNMHNETEIFR
PGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKRAVGTIGAMFLGFLGAAGS
TMGAASVTLTVQARLLLSGIVQQQNNLLKAIKAQQHLLQLTVWGIKQLQARVLAVERYLR
DQQLLGIWGCSGKLICTTAVPWNASWSNKSLNDIWNNMTWMEWEREIDNYTNLIYSLLEK
SQNQQEKNEQELLELDKWASLWNWFDISNRLWYIKIFIMIIGGLVGLRIVFTVLSIVNRV
RQGYSPLSFQTRLPTPRGPDRPEGTEEDGGERDRDRSDRLVNGFLALIWDDLRNLCLFSY
HRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQEIKNSAVSLLNTTAIAVAEGTDR
IIEVVQRIFRAVLHIPTRIRQGLERALL
Download sequence
Identical sequences A0A068EVS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]