SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068EXY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068EXY1
Domain Number 1 Region: 138-481
Classification Level Classification E-value
Superfamily gp120 core 2.55e-175
Family gp120 core 0.000000000155
Further Details:      
 
Domain Number 2 Region: 529-654
Classification Level Classification E-value
Superfamily Virus ectodomain 4.45e-59
Family Virus ectodomain 0.0000061
Further Details:      
 
Domain Number 3 Region: 82-127
Classification Level Classification E-value
Superfamily gp120 core 0.00000000000000942
Family gp120 core 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068EXY1
Sequence length 845
Comment (tr|A0A068EXY1|A0A068EXY1_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MRVTGIRRNYWWKWGTMLLGILMICSATEKLWVTVYYGVPVWKEATTTLFCASDAKAYNK
EVHNVWATHACVPTDPNPQEFVLENVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVELT
PLCVTLNCTDLKNNSREEIKNCSFNITTSIKDKMQKEYALFYKLDIIPIEEEDKDNASYR
NNTSYRLINCNTSVIKQACPKVSFEPIPIHYCTPAGFAILQCNDKKFNGTGPCTNVSTVQ
CTHGIRPVVSTQLLLNGSLAGKEVVIRSANFSDNAKIIIVQLNETVEINCTRPNNNTRKG
IHIGPGRAFYTTGEIIGDIRQAHCNISRAKWNNTLKQIVIKLREQFGNKTIVFNHSSGGD
LEIVTHSFNCGGEFFYCNSTQLFNSTWNSTEESNKAEGNGTITLPCRIKQIINMWQKVGK
AMYAPPISGQIRCSSNITGLILTRDGGKNESTTIETFRPGGGDMRDNWRSELYKYKVVKI
EPLGVAPTKAKRRVVQRKKRDMGIGALLLGFLGAAGSTMGAASLTLTVQARQLLSGIVQQ
QNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTTAVPWN
ASWSNKSLDQIWDNMTWMEWEREINNYTDTIYKLIEESQNQQEKNEQELLELDKWASLWS
WFDITNWLWYIRIFIIIVGGLVGLRIVFIVLSIINRVRQGYSPLSFQTRFPAQRGPDRPE
GIEEEGGERDRDRSGQLVNGFFALIWVDLRSLCLFSYHRLRDLLLIVTRTVELLGRRGWE
ALKYWWNLLQYWSQELKNSAVSLLNVTAIAVAEGTDRVIEVLQRACRAIIHIPVRIRQGL
ERLLL
Download sequence
Identical sequences A0A068EXY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]