SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068F0U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068F0U0
Domain Number 1 Region: 128-287
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 7.46e-74
Family Retrovirus capsid protein, N-terminal core domain 0.000000401
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 6.67e-51
Family Immunodeficiency virus matrix proteins 0.00000861
Further Details:      
 
Domain Number 3 Region: 278-359
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.51e-32
Family Retrovirus capsid protein C-terminal domain 0.0000136
Further Details:      
 
Domain Number 4 Region: 382-433
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 3.37e-16
Family Retrovirus zinc finger-like domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068F0U0
Sequence length 500
Comment (tr|A0A068F0U0|A0A068F0U0_9HIV1) Gag polyprotein {ECO:0000256|RuleBase:RU004487, ECO:0000256|SAAS:SAAS00998370} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASVLSGRKLDTWEQIRLRPGSKKKYKLKHLVWASRELERFACNPDLLETAEGNEQL
LQQLEPALKTGSDSLQSLWNAIVVLWCVHKRYTVEDTQQAIKKLKEVMGSKKSADNKEDT
NTKQTSHNYPIATNAQGQAVHQPLSPRTLNAWVKAVEEKAFNPEIIPMFMALSEGAIPYD
INVMLNAIGGHQGALQVLKEVINEEAADWDRTHPPPIGPLPPGQIREPTGSDIAGTTSTQ
QEQIHWISRAGNPLPVGDIYRKWIVLGLNKMVKMYSPVSILDIRQGPKKPFRDYVDRFYK
TLRAEQASQEVKNWMTETLLVQNANPDCKQILKALGPGATLEEMMVACQGVGGPTHKAKI
LAEAMASAQQDLKGGYTAVFMQRGQNQGRRGPVKCFNCGKEGHVARNCRAPRKKGCWKCG
QEGHHMKDCRNGRQANFLGKYWPPGGERPGNFIQKQMPPPAPSAPPMEEVVKGQENQNQG
ENSNELYPFASLKSLFGTDQ
Download sequence
Identical sequences A0A068F0U0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]