SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068F6V4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068F6V4
Domain Number 1 Region: 7-115
Classification Level Classification E-value
Superfamily PX domain 6.41e-26
Family PX domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068F6V4
Sequence length 225
Comment (tr|A0A068F6V4|A0A068F6V4_9TELE) SH3 and PX3 domain-containing 3-like protein {ECO:0000313|EMBL:AID58108.1} OX=260508 OS=Spirinchus thaleichthys (longfin smelt). GN=SH3PX3 OC=Osmeridae; Spirinchus.
Sequence
GPEWKESPQPFSCSVEDPTKQTKFKGIKTYISYRVTPSHTGRPVYRRYKHFDWLYNRLLH
KFTVISVPHLPEKQATGRFEEDFIEKRKRRLVIWMDHMTSHPVLSQYEGLEHFLMCADDK
QWKLGKRRAEKDEMVGAHFMLTFQIPNEHQDLQDVEERVDTFKSFARKMDESVMQLTHVA
SELVRKHLGGFRKEFQRLGNAFQSISQAFMLDPPHSSDALNNAIS
Download sequence
Identical sequences A0A068F6V4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]