SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068JFS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068JFS9
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.81e-77
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000513
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068JFS9
Sequence length 155
Comment (tr|A0A068JFS9|A0A068JFS9_9EURY) Methyl coenzyme M reductase I {ECO:0000313|EMBL:AIE16199.1} OX=198240 OS=uncultured methanogenic archaeon. GN= OC=Archaea; Euryarchaeota; environmental samples.
Sequence
GGVGFTQYATAAYTDDILDNNVYYDVDYINDKYNGAANVGKDNKVKASLDVVKDIATEST
LYGIETYEKFPTALEDHFGGSQRATVLAAAAGVACALGTANANAGLSGRYLSMYLHKEAW
GRLGFFGYDLQDQCGATNVLSYQGDEGLPDELRGP
Download sequence
Identical sequences A0A068JFS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]