SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068JIR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068JIR5
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.81e-37
Family Gonadodropin/Follitropin 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068JIR5
Sequence length 94
Comment (tr|A0A068JIR5|A0A068JIR5_CLABA) Gonadotropin hormone II beta subunit {ECO:0000313|EMBL:AIE17398.1} OX=59899 OS=Clarias batrachus (Walking catfish) (Silurus batrachus). GN= OC=Clariidae; Clarias.
Sequence
TVSVEKDGCPKCLAFQTSICSGHCFTKEPVYKSPFSSIYQHVCTYRDVRYETIRLPDCRP
GVDPHVTYPVALSCECSLCTMDTSDCTIESLNPD
Download sequence
Identical sequences A0A068JIR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]