SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LC83
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily PX domain 2.62e-27
Family PX domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068LC83
Sequence length 241
Comment (tr|A0A068LC83|A0A068LC83_9TELE) SH3 and PX domain-containing 3-like protein {ECO:0000313|EMBL:AIE43527.1} OX=1517984 OS=Epiplatys duboisi. GN=SH3PX3 OC=Epiplatys.
Sequence
AESYTIEMGPLGPRWKDNPQPFTCSIEDPTKQTKFKGIKTYISYRVTPSHTGHPVYRRYK
HFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLVLWMNHMTSHPVLSQYEG
FEHFLMCTDDKQWKLGKRRAEKDEMVGAHFMLTLQIPTEHQDLQDVEERVDNFKTFAKKM
DDSVMQLTHVASELVRKHLGGFRKEFQRLGNSFQSISQAFTLDPPYRSDTLNNAISHTGR
T
Download sequence
Identical sequences A0A068LC83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]