SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LCJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LCJ3
Domain Number 1 Region: 5-133
Classification Level Classification E-value
Superfamily PX domain 5.49e-26
Family PX domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LCJ3
Sequence length 241
Comment (tr|A0A068LCJ3|A0A068LCJ3_9TELE) SH3 and PX domain-containing 3-like protein {ECO:0000313|EMBL:AIE43612.1} OX=188134 OS=Poeciliopsis scarlli (Michoacan livebearer). GN=SH3PX3 OC=Poeciliinae; Poeciliopsis.
Sequence
AESYTIEMGSLGPQWKANPRPFICSIEDPTKQTKFKGIKTYISYRVTPSHIGRPVYRRYK
HFDWLYNRLLHKFTVISVPHLPEKQATGRFEEDFIEKRKRRLILWMNHMTSHPVLSQYEG
FEHFLMCADDKQWKLGKRRAEKDEMVGAHFMLTLQIPNEHQDLQDVEERVDNFKTFAKKM
DDSVMQLTHVTSELVRKHLGGFRKEFQRLGNAFQSISQAFTLDPPYKSDALNNAISHTGR
T
Download sequence
Identical sequences A0A068LBK2 A0A068LBW0 A0A068LCH1 A0A068LCH8 A0A068LCJ3 A0A068LHN3 A0A068LHN9 A0A068LHP4 A0A068LHP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]