SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LH50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LH50
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 6.41e-59
Family gp120 core 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LH50
Sequence length 114
Comment (tr|A0A068LH50|A0A068LH50_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46466.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIMPVVSTQLLLNGSLAEEGIIIKSENITNNAKTIIVHLNNSVEIECTRPG
NNTRKSIRIGPGQTFYATGEIIGDIRQAHCNISEAKWNTTLEEIVKKLREQFPN
Download sequence
Identical sequences A0A068LGU8 A0A068LGW6 A0A068LH50 A0A068LH55 A0A068LHL9 A0A068LHM4 A0A068LJ88 A0A068LJ92 A0A068LJ98 A0A068LJA3 A0A068LMX7 A0A068LMY4 A0A068LMY9 A0A068LMZ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]