SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LH84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LH84
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 9.68e-59
Family gp120 core 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068LH84
Sequence length 114
Comment (tr|A0A068LH84|A0A068LH84_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46496.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIMPVVSTQLLLNGSLAEEEIIIKSENITNNAKTIIVHLNKSVEIICTRPG
NNTRKSVRIGPGQTFYATGEIIGDIRQAHCNISEGNWTKTLQEIAIKLREHFPN
Download sequence
Identical sequences A0A068LGX2 A0A068LGX9 A0A068LGY4 A0A068LGZ0 A0A068LGZ5 A0A068LH66 A0A068LH71 A0A068LH78 A0A068LH84 A0A068LH91 A0A068LHN0 A0A068LHP0 A0A068LHP5 A0A068LHQ1 A0A068LJA7 A0A068LJB1 A0A068LJB5 A0A068LJC2 A0A068LN02 A0A068LN08 A0A068LN15 A0A068LN21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]