SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LHZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LHZ0
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 1.08e-57
Family gp120 core 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068LHZ0
Sequence length 114
Comment (tr|A0A068LHZ0|A0A068LHZ0_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46582.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENITNSVKTIIVHLSEPVGIECTRPG
NNTIKSMRIGPGQAFYATGQIVGDIRQAHCNISASQWNDTLQKVERKLGEHFPN
Download sequence
Identical sequences A0A068LH93 A0A068LH99 A0A068LHA7 A0A068LHJ9 A0A068LHZ0 A0A068LI14 A0A068LJM2 A0A068LJM6 A0A068LNC5 A0A068LNC9 A0A068LND2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]