SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LI15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LI15
Domain Number 1 Region: 86-199
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.88e-56
Family Retrovirus capsid protein, N-terminal core domain 0.000000627
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 5.49e-38
Family Immunodeficiency virus matrix proteins 0.0000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068LI15
Sequence length 199
Comment (tr|A0A068LI15|A0A068LI15_9HIV1) Gag protein {ECO:0000313|EMBL:AIE46741.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
FALNPGLLETSAGCKQIMKQLHPALQTGTEEIKSLYNTVATLYCVHEGIEVRDTKEALDK
IEEEQKKCQQKTQQAEAPDKGKVSQNYPIVQNLQGQMVHQPLSPRTLNAWVKVIEEKAFS
PEVIPMFTALSEGATPQDLNTMLNTVGGHQAAMQMLKDTINEEAAEWDRLHPVHAGPVAP
GQMREPRGSDIAGTTSNLQ
Download sequence
Identical sequences A0A068LHR3 A0A068LHR6 A0A068LI10 A0A068LI15 A0A068LI18 A0A068LI24 A0A068LII2 A0A068LII5 A0A068LII8 A0A068LIJ2 A0A068LK23 A0A068LK27 A0A068LK29 A0A068LK39 A0A068LNT9 A0A068LNU3 A0A068LNU7 A0A068LNV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]