SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LJS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LJS9
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily gp120 core 1.83e-55
Family gp120 core 0.00000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LJS9
Sequence length 114
Comment (tr|A0A068LJS9|A0A068LJS9_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46640.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEEKIIIRSKNITENDETIIVQLKTSVEINCTRPN
NNTLTSIRIGPGQAFHATGKIIGDIRQAYCTVNGTEWNRTLYEVSEALTKYFPG
Download sequence
Identical sequences A0A068LHI5 A0A068LHJ3 A0A068LHQ4 A0A068LHS9 A0A068LHU0 A0A068LHU6 A0A068LIA0 A0A068LIB3 A0A068LIB7 A0A068LIC1 A0A068LJS9 A0A068LJV1 A0A068LJV9 A0A068LJW7 A0A068LNH6 A0A068LNK1 A0A068LNL8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]