SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LN47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LN47
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 2.35e-59
Family gp120 core 0.00000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LN47
Sequence length 114
Comment (tr|A0A068LN47|A0A068LN47_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46519.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIMPVVSTQLLLNGSLAEEEVIIKSENITNNAKTIIVHLNKSVEIVCTRPG
NNTRKSIRIGPGQTFYATGEIIGDIRQAHCNISEAKWNTTLEEIVKKLREQFPN
Download sequence
Identical sequences A0A068LH02 A0A068LH07 A0A068LH19 A0A068LHQ7 A0A068LHR2 A0A068LHR7 A0A068LHS1 A0A068LJD2 A0A068LJD8 A0A068LN28 A0A068LN35 A0A068LN40 A0A068LN47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]