SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LNH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LNH0
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 5.76e-59
Family gp120 core 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068LNH0
Sequence length 114
Comment (tr|A0A068LNH0|A0A068LNH0_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46634.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEEGIIIRSENITNNVKTIIVHLNESVEIMCTRPN
NNTRKSMRIGPGQTFYATGDIIGNIRQAHCNISAKNWTNTLKRVGKKLQEHFPN
Download sequence
Identical sequences A0A068LHE6 A0A068LHM8 A0A068LHP1 A0A068LI52 A0A068LI60 A0A068LI68 A0A068LJS4 A0A068LNF9 A0A068LNH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]