SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068NUE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A068NUE1
Domain Number - Region: 153-180
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0267
Family Type II restriction endonuclease effector domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A068NUE1
Sequence length 207
Comment (tr|A0A068NUE1|A0A068NUE1_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AIE85234.1} KW=Complete proteome; Reference proteome OX=661478 OS=Fimbriimonas ginsengisoli Gsoil 348. GN=OP10G_1866 OC=Fimbriimonadaceae; Fimbriimonas.
Sequence
MFLRSSCLVAGLFLAGCAAKTGSPPVVQDSEEVRYFLEHKERWAVKTGADADAGKIPLSD
ATPTTVEHLRSLEPPGFIPKHGGDADRRFDPVETTLYSLDVDLVRYKLETDDQDFHVVVR
DHDGSSVTMIVEFVDPTFVSHASPFRSMITAARAKFDSIYHPRTSWGRKRGHLRITGVGF
FDFKHGQSGVAPNAIELHPVLSCEILE
Download sequence
Identical sequences A0A068NUE1
WP_025226177.1.45701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]